PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009613092.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 394aa    MW: 45067.1 Da    PI: 7.9822
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009613092.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.81.1e-49401652128
             NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                     +pGfrFhPt+eelv +yL++kvegk++++ e i+ +d+y+++Pw+Lp++++ +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ + s++
  XP_009613092.1  40 MPGFRFHPTEEELVEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPAMAAIGEKEWFFYVPRDRKYRNGDRPNRVTTSGYWKATGADRMIRSES 133
                     79***************************.89***************888889****************************************** PP

             NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                     ++ +glkktLvfy+g+apkg +++W+m+eyrl
  XP_009613092.1 134 SRPIGLKKTLVFYSGKAPKGIRSSWIMNEYRL 165
                     ******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100555.62439186IPR003441NAC domain
SuperFamilySSF1019414.32E-5639186IPR003441NAC domain
PfamPF023651.5E-2441165IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 394 aa     Download sequence    Send to blast
MAIAPFTSMS QSQQQQDDSS SNKRDHDHDA DDEHEHDMVM PGFRFHPTEE ELVEFYLRRK  60
VEGKRFNVEL ITFLDLYRYD PWELPAMAAI GEKEWFFYVP RDRKYRNGDR PNRVTTSGYW  120
KATGADRMIR SESSRPIGLK KTLVFYSGKA PKGIRSSWIM NEYRLPHHET ERLQKAEISL  180
CRVYKRPGVE DHPSLPRSLP TTRASSSSSS RAHNSIIKKH HHPQVVQDPL LLSPNYVGQS  240
NSQQIDEKLN ENSTASSTST DHHHHHRHVG TSLGLSSHQI TALTTSTITP FSSLISPNNT  300
AAVDDLQRLV NFQNLHNHQQ HFQNLSNHNI PAASIATHQF STLLQPQLAP QQPQPNLLLQ  360
GSLQPSAFSE RLWDWNSVQT DGSCKDYQPN NPFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-554118619165NAC domain-containing protein 19
4dul_A1e-554118619165NAC domain-containing protein 19
1ut7_B1e-554118619165NO APICAL MERISTEM PROTEIN
1ut7_A1e-554118619165NO APICAL MERISTEM PROTEIN
1ut4_B1e-554118619165NO APICAL MERISTEM PROTEIN
1ut4_A1e-554118619165NO APICAL MERISTEM PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00257DAPTransfer from AT2G02450Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009613092.10.0PREDICTED: NAC domain-containing protein 19-like
TrEMBLK4B1K21e-151K4B1K2_SOLLC; Uncharacterized protein
STRINGSolyc01g102740.2.11e-150(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38882446
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.21e-116NAC domain containing protein 35